SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K3XBD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3XBD3
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000111
Family Ubiquitin-related 0.0049
Further Details:      
 
Domain Number 2 Region: 126-163
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000833
Family HkH motif-containing C2H2 finger 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3XBD3
Sequence length 321
Comment (tr|K3XBD3|K3XBD3_PYTUL) Uncharacterized protein {ECO:0000313|EnsemblProtists:PYU1_T014532} KW=Complete proteome; Reference proteome OX=431595 OS=Pythium ultimum DAOM BR144. GN= OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MDVFVRAPNNLLHTIRCAGQQSVLEFKHAVQDATRVPLEAMKLRFATSLLADDGAMLSDY
KIQHGASISIHLSLRGGIDFQNRAGSKPGAGGVASESQSNIDRRERLRKLALETVDLAKD
PYFMKNHLGSYECKLCLTLHNNEGNYLAHTQGKRHQTNLARRAAKEASDAAHSASAANLL
AAKAAAAAAAARPRALKIGLPGYKVTKQRDPDTGARILLFQIAYPDHDPKLQPRHRFMSA
FEQKIEAPDKNFQYLLFACEPYETVAFKIPNLEIDKSEGKFFSNWDKNGKTFTLQLYFAV
DSDEKKDQPAPPPPRPQLRYL
Download sequence
Identical sequences K3XBD3
PYU1_T014532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]