SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4ATH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4ATH7
Domain Number 1 Region: 27-226
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.4e-26
Family BAR domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K4ATH7
Sequence length 632
Comment (tr|K4ATH7|K4ATH7_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc01g009820.2.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101265569 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MKTSLKKLRGLATLRHERKERRLRQPSDELAMAAQDMQEMKDCYDRLLSAAAATANGAYE
FSESLREMGDCLLEKTALNEDEESGKVLLMLGKLQFQLQRLVDNYRSHIIQTISVPSESL
INELRVVEEMKMQCDDKREVYEKMMQKHRDKGRVKGSKGEHISSHQLQVAYEDYDEGANV
FVFRMKSLRQGQSRNLLTQASRHHAAQLSFFKKALKSLEEIEPHVKLVTELHHIDYHFRG
LEEDDGVNAGNDNENSSEDDSDVGSESLDDGELSFDYGQNDQVYTSTHSMELDKVDVAVS
EVASKGASKENLSKIHGGNSFSFFRDVNITKSAPLLSGRKPDPAEGAARMTSSLSNKFQP
YVLPTPVEVKIPESVKSHNIDLQTKRTSQTSGVVQKWHSSPLDQFKYEKLMAGDKFPGPI
TVNTQSVPTESKNNASTGWLPPPLSEGLSSAQRDLSNAKKVKRQAFSGPLTAKPWPKKPI
VSSGSPIASSGYPLHFSLPFLHTSTPEPSSTPKLSSRASLMSSPKISELHELPRPPAKIT
TTRPLRPVTRSGPLVSKVQDFSPTNKAAVSSAASTLPTPPALPRSYSIPSRGQIETSLHV
SKPLEDMTSSPPLTPIALVKDRHTSPASQPPS
Download sequence
Identical sequences K4ATH7
XP_004228436.1.44838 Solyc01g009820.2.1 Solyc01g009820.2.1 Sopim01g009820.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]