SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4AYX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K4AYX0
Domain Number - Region: 179-224
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0251
Family IMD domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K4AYX0
Sequence length 259
Comment (tr|K4AYX0|K4AYX0_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc01g090290.2.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101258190 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MDIEQKQAEHIDFFVKQASALKGSALTTVIVEATSHPSLFAFSEILSVPSVLELGGTENS
VYLDLLRLFAHGTWSDYKSIAGCLPQLASAQALKLKQLTVLTLADTSKELPYDQLMQELD
VTNVRELEDFLINECMYVGIVRGKLDQLKRCFEVQFAAGRDLRPGQLGNMLQTLTDWLTT
SDNLLVSIQEKIKWADTMSESDRKHRKEVEERVDEVKKSLSLKADVDFRGHEEIYSESGG
VMDYEEDRGRPKRRRHPIG
Download sequence
Identical sequences K4AYX0
XP_004229749.1.44838 Sopim01g090290.0.1 Solyc01g090290.2.1 Solyc01g090290.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]