SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4B329 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4B329
Domain Number 1 Region: 120-218
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-22
Family B3 DNA binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K4B329
Sequence length 336
Comment (tr|K4B329|K4B329_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc01g108130.2.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101264981 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MEERNFIPVKRRTKSCKKRQQQVEPHTLKSTSHSSASTSTQTDPLSMIKTVQLDRKKMIP
KKPRSVKSKAKQVKSNHPRKAESHSIKRKGSKRTRINDLYDDVEAKYSVMERAEKVLSSL
PDEFPSFAKCMLPSNVAHGFWLHLPKSFCNMHLPSSDTTVILVDEWGNEYKTSYLLERNG
LSAGWRGFSISHRLLKGDLLIFRLIEPCKMKVYIVRVNGQEVVDAALCLMYWETLNTSTE
LDLVRKDKRKRKKAKHLAEPFFVDLSKPKEHVQNDSHCTVDLNVSPSEHRSENNSEDLDS
EVLQGSDVTNRLQSNEICCSETSFLHDNPHKSVDCR
Download sequence
Identical sequences K4B329
Solyc01g108130.2.1 Sopim01g108130.0.1 XP_004230782.1.44838 Solyc01g108130.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]