SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4B3A7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4B3A7
Domain Number 1 Region: 175-272
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-23
Family B3 DNA binding domain 0.0092
Further Details:      
 
Domain Number 2 Region: 11-105
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-20
Family B3 DNA binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K4B3A7
Sequence length 285
Comment (tr|K4B3A7|K4B3A7_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc01g108930.2.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN= OC=Solaneae; Solanum; Lycopersicon.
Sequence
MENSLLKIDKRAIFYKVFCPSITNELRIPAHFLRHVSEESPDKATLKCLSGGTWNVKLQC
DEDGLLIQKGWKKFQKNNQLENGEYLVFRYDGALQFTIRIFSKNGLERQVKSTNMVENQQ
ASIDGGSKRKRPEKFPKKTCANGENETEDVCCVSLEHETRRKRAALVTEEDLLTPNIPQF
VKCLKGYNVKKSCFLYVPRWFSEQLSTSGNKRAAVLRNSEGKGWKVNCITQNGYHAFCGG
WKQFVSDNNLKEGQVCVFQLVNANELKVSVFNDPSESLLKLAAQR
Download sequence
Identical sequences K4B3A7
Solyc01g108930.2.1 Sopim01g108930.0.1 Solyc01g108930.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]