SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4B480 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4B480
Domain Number 1 Region: 743-829
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.93e-21
Family PB1 domain 0.0037
Further Details:      
 
Weak hits

Sequence:  K4B480
Domain Number - Region: 148-218
Classification Level Classification E-value
Superfamily GAF domain-like 0.025
Family GAF domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K4B480
Sequence length 841
Comment (tr|K4B480|K4B480_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc01g112190.2.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101256430 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MEDAAFTLLAKLHDDNNATDFTEFGFWLEATDQPSNSNSNYCTSNQMDSAPPTQSRRKLW
IGPNNPNPTSSIPPVNTRLVQAIEYLKNSTTHNKEVLIQIWVPVNRGGKHVLITNNQPYF
LNPNSHSLLQYRNVSQNYQFAADKDSNELVGLPGRVFLKKLPEWTPDVRFFKSEEYPRVN
YAHQHNVRGSIAVPVFETGSGTCLGVVEIVTTIQKTHYHLELEHVCKALEAVNLRSSGIS
SNPSKIKDQDCNESYLAALAEIQYILTCVCDTHKLPLAQTWAPCIQQGKGGCLQSDENFA
SCVSTVDSSCYVRDQHVVPFHLACSEHHLLKGEGVAGGAFNTNQPCFATDITAFSKAEYP
LSHHARMFGLCSAVAIRLRSIYTGSADFVLEFFLPLDCKNTEEQKIMLSSLSSVIQQSCR
SLRVVTDQELQEEKEVVRLPIGEEESRKPVSSSYRDQDASSWLSEMLDAQRKGKGAAAVS
ENFKVTATPWDYTQRESIHASTFSEPNQTFEPKGGSFDFSSGTGSHSSGAKRAGERRRSK
TEKSISLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKVGHSLQKLQ
LVIDSVHGAEGAIKLSSFYTNFPELNSPNNPGTSNFSASKNDDHLQQVNTQPDGSPVTTT
SKSTSSSGSHNSSSSLFCSTGSKNCTTEENPGGMPKRAHTETGLHDMGQEETKLLVRSQS
QKIQSNHNSVEPVCPLSTSSNQVLGRFKVKAIFGKEKIRFSLQSHWGFRDVKHEVMRRFN
VEDVGKIDLKYLDDDDEWVLLTCDADLEECIDIHKFSKRRTIKVSLHHTNLGSSFGSSGP
A
Download sequence
Identical sequences K4B480
Sopim01g112190.0.1 XP_004231096.1.44838 Solyc01g112190.2.1 Solyc01g112190.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]