SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4B8A9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4B8A9
Domain Number 1 Region: 10-218
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.07e-25
Family BAR domain 0.042
Further Details:      
 
Domain Number 2 Region: 229-306
Classification Level Classification E-value
Superfamily SH3-domain 8.27e-19
Family SH3-domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K4B8A9
Sequence length 317
Comment (tr|K4B8A9|K4B8A9_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc02g071330.2.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN= OC=Solaneae; Solanum; Lycopersicon.
Sequence
MVIDEMEMQLHHQLDKLYKSTREKRDFQKEIVKAAETFTAIGYKHIEPGTKLSEDCCKYG
VENPNDEVLAKAASIYGDARKHAEKEVEDLNKLFFSQVLEPLRAMVAGSPLEDARHLAQR
YSKMRQEAEIQATEVSRRQARVREAPIPENVAKLHSAETKMQELKANMTVLGKEAAAALA
AVESQQERLTFQRLVAMVEAEKLYHERVAVILGNIEAEIVSEKQRKEAAPPVATLPVNPP
AQIPEKTKYFLAEAIHSFEAESEKELSLSVGDYVVVRKVTQSGWSEGECQGRAGWFPSEY
VEKRQRVPTSNGATEAY
Download sequence
Identical sequences K4B8A9
Solyc02g071330.2.1 Sopim02g071330.0.1 Solyc02g071330.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]