SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4BKJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4BKJ3
Domain Number 1 Region: 106-187
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000000378
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K4BKJ3
Sequence length 199
Comment (tr|K4BKJ3|K4BKJ3_SOLLC) Auxin-responsive protein {ECO:0000256|RuleBase:RU004549} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101250590 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MDKIMEEEDSFHSNTDAIIYPISDVSQSLLSDPNIASSPSTSADDQQQQPHQWTTAAAAA
VGYSNDDLSVSVSVSSACSRISYKQIDKDQIDVSKAKERVQLPKDFTSSRSRIKVHMQGV
AVGRSVDLTVLRGYDELISVVEEIFDIKGELSPRIKWQLVYRDDEGDMMLVGDYPWPEFC
EMVRKLYIYSREEVKKKYS
Download sequence
Identical sequences K4BKJ3
Solyc03g113410.1.1 Solyc03g113410.1.1 XP_004236521.2.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]