SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4BPH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K4BPH6
Domain Number - Region: 447-568
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0068
Family IMD domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K4BPH6
Sequence length 715
Comment (tr|K4BPH6|K4BPH6_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc04g010220.2.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101267106 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MSWLRSAMNKAVEVGNSNLTRTVRNYADSVGHAVAEGAKILQDRIGNRNFKSFKQTVQRL
EEASISCKGPERVQLMKRWLAALKAIDNMSEVSVEDKEKNNEQQHPSEEVRKQPLVLYYD
SEMGGEPLNFRDVFLYSKGLEGMVICMILEAPNEEEISLLLELFELCLTGGKAVHSAIIS
SIQDLSNAFSNYQDEVLVKREELLQFAESAITGLKSNADLGRIDAEVSTLNKQLDEIKAV
KDASGDHETISKETAASIEALKVALAHIRVCSRLEGLLLKKKSLKYGDSPEVHSQKVDKL
KLLSESLVRSANKAEKEISDDRIQKEEALKFRVAKTSEVGEIEKELAAEISALEKQRNEI
EAQLKQVNISLAAASARLHNAREERDQFYDANDQIVAHLKTREGELSKTIGSCRVEEHVV
SSWIKFLEDAWVLQSSYTETKDKEAKVELEKHEDYFVNLVLQLLSDYEKELRPSIDRIRK
YVENLKSLGEGSAKEAGLSSGESKALSPRKSLELEYLDYEAKIITTFSVVDNMMEQFYAQ
HGKVSRKDDPKIKGLFENIEKLREEFESIERPELEMEIPDAPTQEGDASSHNIPDENKSD
PARKATEAPETGTNEENKPPSTKAENVSNAAPNKVPENVSSSARKTIEAPTAGAKEEKKP
AATSAEQMYEAELAKLESESGNINQDFTAEEIGGWEFDELENELNSGTRAIPEKR
Download sequence
Identical sequences K4BPH6
Solyc04g010220.2.1 XP_004236767.1.44838 Sopim04g010220.0.1 Solyc04g010220.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]