SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4BUC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4BUC3
Domain Number 1 Region: 227-330
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.4e-21
Family PB1 domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K4BUC3
Sequence length 349
Comment (tr|K4BUC3|K4BUC3_SOLLC) Auxin-responsive protein {ECO:0000256|RuleBase:RU004549} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=543750 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MSPPLLGVGEEEGQSNVTLLASSTSLGSICIKGSALKERNYMGLSDCSSVDSCNISTSSE
DNNGCGLNLKATELRLGLPGSQSPERGEETCPVSSTKVDEKLLFPLHPSKDTAFSVSQKT
VVSGNKRGFSDAMDGFSEGKFLSNSGVKAGDTKETSRVQPPKMKDANTQSTVPERPSAVN
DASNRAGSGAPATKAQVVGWPPIRSFRKNTLASASKNNEEVDGKAGSPALFIKVSMDGAP
YLRKVDLRTCSAYQELSSALEKMFSCFTIGQYGSHGAPGKDMLSESKLKDLLHGSEYVLT
YEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDAIGLAPRAMEKCRSRN
Download sequence
Identical sequences K4BUC3
Sopim04g076850.0.1 Solyc04g076850.2.1 NP_001265888.2.44838 Solyc04g076850.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]