SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4C0Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4C0Y0
Domain Number 1 Region: 121-259
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.15e-41
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 1003-1063
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000265
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K4C0Y0
Sequence length 1097
Comment (tr|K4C0Y0|K4C0Y0_SOLLC) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=100736463 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MKTPGNGAGGGNVNPAEGEKKNLNPELWQACAGPLVNLPVAGTHVVYFPQGHSEQVAASI
KKDVEAQIPNYPNLPAKLICLLHNVTLHADPETDEVYAQMTLQPVPSFDKEALLRSDLSM
KANKPQPEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDYSLQPPAQELVARDLHDNIW
TFRHVYRGQPKRHLLTTGWSLVVSGKRLFAGDSVLFIRDEKHQFLLGIRKANRQPTNLSS
SVLSSDSMHIGILAAAAHAAANNSPFTVFYNPRAGPSEFVIPLAKYYKATYSSQISLGMR
FRMMFETEESGTRRYMGTITGISDLDPVRWKNSQWRNLQVGWDESTAGERINRVSIWEIE
PITAPFLICSSPFFSSKRPRQPGMPDGDYSDMDGMFKRTMPWLGDDFGMADPQGLPGLSL
IQWMNMQKNPSLANPMIPNYMNSLSGSALQNLAGADLSRQLGMAAPQFQQQQQMQHNLQF
NNAHRPNQQLDQLQKLPAAALNSLDSIMQSQQQLSDVSQQPRQNLTTQSLPTTQVHTQHI
QAQSLGQSQNVLPPQQSVQNQNQLQRNLPQSLSQQHPQQQILGQTQQQSFMSSQAPDPVN
QQQHFSDNQAQLQMLQKLHQQQKSLLAQQSGLQQPSQLGSIQDHQKQLMDASQNFSRSLA
TNQMLDASQTTSTSLPHSQVVQQQMTRINSPSNLRFSQPTQQPKLQQQQSGNLSDLSGPV
NYPLPRTSYQLSANGSNLTGTAGGGQSVVIDDVPSWSTSVSTNNCHSVVQPNMNGRITGA
RDEMTHCSGPLEVMSANNNLQPKSDVKPSVNVVSKSQNHGFLAPQTLNTSGIQFDYLDSS
SSATSACLSQNDVQLQQTATDPLSGSSQPLIFRDSPDGGEVQGDPRNNVAFGAANMENNQ
LGLPMIPDPLITKSSMGSRKDFSDNLSSGGGMLSSYENPKEAQPELLASMASDYVTFNSI
DSTINDGSFMDRGAWEPPPQLPRLRTYTKVYKRGAVGRSIDIARYSGYEELKLDLARRFG
IEGQLEDRQRIGWKLVYVDHENDVLLVGDDPWEEFVSCVRCIKILSPQEVQQMSLDGDFG
GSVLQNQDCSSSDAGDV
Download sequence
Identical sequences K4C0Y0
XP_010321285.1.44838 Solyc05g047460.2.1 Solyc05g047460.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]