SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4CAV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4CAV9
Domain Number 1 Region: 8-153
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.6e-32
Family Universal stress protein-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K4CAV9
Sequence length 157
Comment (tr|K4CAV9|K4CAV9_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc06g084540.2.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101246641 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MGEKPVMVVGLDDSEYSFYALEWTLEHLFRSSPPPFKLLIVHAKPTATSAIGLAGPGGAD
VLPYVEADLRKISSRIAEKAKKICSAKSVNDVVVEIAEGDARSVLCDAVEKHHASMLVVG
SHGYGVLKRAVLGSVSDYCAHHTHCSVMIVKRPKIKA
Download sequence
Identical sequences K4CAV9
Solyc06g084540.2.1 Solyc06g084540.2.1 XP_004242313.1.44838 Sopim06g084540.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]