SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4CBK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4CBK9
Domain Number 1 Region: 37-143,509-585
Classification Level Classification E-value
Superfamily TPR-like 4.69e-27
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 
Domain Number 2 Region: 317-411
Classification Level Classification E-value
Superfamily CAD & PB1 domains 7.01e-16
Family PB1 domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K4CBK9
Sequence length 778
Comment (tr|K4CBK9|K4CBK9_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc07g007390.2.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101256392 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MGKESWTKSKKIGGKSGESSSPRAFDKDTAVFIAMSKELKDEGNKLFQKRDYEGAMLKYD
KAIKLLPRNHIDVSYLRSNIAACYMQMGLSEYPRAIHECNLALEVTPKYSKALLKRARCY
EALNRLDLAQRDVNRVLEMEPNNLMATEIAERVKTTIEERGIGVNDIPVDLIPVPEYVEP
TFVSSHSKSSKEKALKKKIKKVEEKMVNGKAEEKEFDAGVDLKQTDNRNEERNTEDQNEN
TDKDQTKEEKVDDKTEGNKAENKTNRKKAKDKSKEKKNKDKIEVNKVKDRFEENKDEDNE
ERKTEDKLVVEEIISHTTEEEPKRTVKLVFGDDIRWAQVPVDCSILTLREIIGDRFPSLK
AVLIKYRDQEGDLVTVTTNEELRWAEASVGHGSIRFYIVEVSPEQDPFYEKIKGVEDDHK
YNARHDKIVENGNVETSKELHNGPVCINDWIFQFSNLFKNYVGFESDDYLDLHEVGMKLY
SEALEEAITSEEAQYLFSTAGETFQEMAALALFNWGNVHMSRARKRVYLKEDSSGESLLA
QIKIAYDWALKEYSKAGERYEEALNIKPNFYEGILALGQQQFEQAKLSWYYTISTGVNLD
SWPSTEVLQLYNSAEENMERGMQMWEEAEEQRLNELSSTNKLQKMKSENLFKGISADEAS
EQAANMMSQINLLWGTMLYERSLMEFKLGLPLWQESLEVAVEKFELAGASPTDIAVMIKN
HCSNSTATEGLGFNIDEIVQAWNEMYEAKRWERGVPSFRLEPLLRRRVSKLYHALELA
Download sequence
Identical sequences K4CBK9
Sopim07g007390.0.1 XP_004242725.1.44838 Solyc07g007390.2.1 Solyc07g007390.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]