SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4CE89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4CE89
Domain Number 1 Region: 116-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.76e-43
Family B3 DNA binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 1012-1089
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000177
Family PB1 domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K4CE89
Sequence length 1137
Comment (tr|K4CE89|K4CE89_SOLLC) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=100191131 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MKAPSNGYLPNSGEGERKLMNSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKE
TDGIPSYPNLPSKLICMLHNVTLHADTETDEVYAQMTLQPVNKYDQEALLLSEMGLKQNR
QPAEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDYAMQPPAQELMARDLHDQTWTFRH
IYRGQPKRHLLTTGWSVFISSKRLCAGDSVLFIRDEKSQLLLGIKRTNRQQPALSSSVIS
SDSMHIGILAAAAHAAANNSPFTIFYNPRASPSEFVIPLAKYNKAMYAQVSLGMRFRMMF
ETEESGVRRYMGTITGVSDLDPIRWKSSQWRNLQVGWDESTAGERPSRVSIWDIEPVVTP
FYICPPPFFRPKFPKQPSFPGDESDIENVLKRGMPWINDELGLKDAQNSIFPGLSLVQWM
SMQQNNHVPVAQSGLPSVLHSNIGSDDHSKLLNFQSPALATPGLQFNKPNQLNQPFGQIQ
QPPLAWTQEQQQSLQSPVSAQQQQQQQHTLQQQQQQQQHTLQQQQQQRHTLQQQQQQQTL
QQQQQQQQQQHTLQQQQQQQHTLQHQQQHTLQQPQQHMLQQQPQFHQQAQQQLQQQQRPS
QQQQLTGNSSPVNRCVSPNQIPNQTFPQAAVYGQLQQQQVLSASTQSQQNVPVSRNSFPS
TSLAQDFQFQQQMEQQSNLLQKSQQQQTIPQQAPLQLLQQSLMQRSQVQPSSQQSLTEQQ
LQLQLLNKLQQQQQQQQAQLLSPVSSTLEPRMPQQQQNRQPQELQFAHQQLSSNIVTTVT
HLQSTHHAFNQLQNHHKSPITIKALSGGTEGDAPSCSTSPSTNNFQVSPPNFLTRNQGQA
ILVDESVVDPSQEQNKSECRIKHELVFSKGSELSKYKGNNTENLEAASSTTSYGLDSSGF
NFSLPALCVDGDVQSHSRNILPSAANNIDGLNPDALLSRDYDSGKDIQNLFSPFGNAPRD
IETELSDAGINSQQFGVPNMSYKPRCANDLAVNDNGILNNNAWTNQTQRMRTYTKVQKRG
SVGRTIDVTRYIGYDELRHDLARMFGIEGQLEDPQRTEWKLVYVDHENDILLVGDDPWEE
FVSCVQSIKILSCAEVQQMSLNGDLGNVPVPNQASSGTDSGNAWKGHYDDNSAASFN
Download sequence
Identical sequences K4CE89
Solyc07g042260.2.1 XP_004243692.1.44838 Solyc07g042260.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]