SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4CIB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4CIB5
Domain Number 1 Region: 8-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.12e-18
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 2 Region: 137-226
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-17
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K4CIB5
Sequence length 251
Comment (tr|K4CIB5|K4CIB5_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc08g006260.1.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN= OC=Solaneae; Solanum; Lycopersicon.
Sequence
MEVTSVQPHFFKPLLPGFKNSLKIPDGFLKYLEGCEEKGRALLKKGGKKWVVKLNGQKLE
EGWGQFAEEHDLKLGDMLIFRHEGDLEFDVTVFNLNHCDREYAEYEEEEEEVRTVEETST
NFEFKEGSTHIPFGQSQFICTVKPYCLRNGYLRVPCKFAKANGLTNKECGLIIRDERQRS
WNLRIYTSCSQVYIGGRWSEFRAANDIKKGDQIMFEVVSNGEQPIWNFHGWQRITTDTIW
CFFVKELWLHL
Download sequence
Identical sequences K4CIB5
Solyc08g006260.1.1 Solyc08g006260.1.1 Sopim08g006260.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]