SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4CIX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4CIX5
Domain Number 1 Region: 912-998
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.27e-20
Family PB1 domain 0.006
Further Details:      
 
Weak hits

Sequence:  K4CIX5
Domain Number - Region: 388-456
Classification Level Classification E-value
Superfamily GAF domain-like 0.00471
Family GAF domain 0.019
Further Details:      
 
Domain Number - Region: 206-272
Classification Level Classification E-value
Superfamily GAF domain-like 0.0051
Family GAF domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K4CIX5
Sequence length 1008
Comment (tr|K4CIX5|K4CIX5_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc08g008410.2.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101261639 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MSEPGGGMTQNHLPKSKELTPATVTERESMMMDLDFDIDASWSFDQIFAAAAAVSSNPAS
PFLPCSPLWAFPDDNDEKPAGNGLSGALRISGHPRFVAYTGDLEATTETISVNTDKGRLT
SPISGLLPGDNPEGSCIIKERMTQALRYLKETSGERVLAQVWAPVKEAGRSVLTTSGQPF
VLDPECNGLHQYRTVSLMYMFAADGETDGVLGLPGRVFRLKLPEWTPNVQYYSSKEFPRL
DHALNYNVRGTLALPVFEPSGRSCVGVLELIMTSQKINYAAEVDKVCKALEAVNLKSSDI
LDHPNTQVYVMGYMNQICNEGRQNALVDILEILTAVCETYKLPLAQTWVPCRHRSVLADG
GGLRKSCSSFDGSCMGQICMSTTDVAFYVVDAHMWGFRDACAEHHLQRGQGVAGRAYASR
KSCYCEDITQFCKTEYPLVHYARMFGLTSCFAICLRSSHTANDDYILEFFLPPNSGDYSD
QPALLNSLLLTMKQHFRSLSIASGEELEHDWGSVEIIQASMEEKIDAKPESVPTAKTSPQ
LTSLPNGWVHLDPVGEQQSAVGSNVSKGARSTSGTGEAPNNVSNSDNKTSGKKSERKRGK
AEKTISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKVNRSLSKLK
CVIESVQGAEGAFTLTSLAPNSLPAAVSSISWPAGANVSNLPSSPSSKPSVFPEEKNEFF
HHGTPESHIEAEPSNQMLGGRVARKEEFTPMQNGFLHAEGTHKSRTGSVSREESAGTPTS
HGSCQGSPCAGNGFSPQNELVNSPAHESCMKVGGSLEAARQTTAEINLSSAFLMPQPIIP
KHTQEPFGGMLVEDAGSSHDLRNLCSPRDALVDERVPDYNLTNPPFSDAIAKDPVYVPPD
TIQQYSAWPEVTSVTIKATYKEDIIRFRLCLSSGIVKLKEEVAKRLKLELGTFYIKYLDD
DLEFVPISCDADLQECVDISRSSGSSIVRLLIHDIMSNLGSSCESSGK
Download sequence
Identical sequences K4CIX5
Solyc08g008410.2.1 Solyc08g008410.2.1 XP_004244640.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]