SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4CR42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4CR42
Domain Number 1 Region: 81-290
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000068
Family BAR domain 0.057
Further Details:      
 
Domain Number 2 Region: 2-33
Classification Level Classification E-value
Superfamily PX domain 0.000017
Family PX domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K4CR42
Sequence length 295
Comment (tr|K4CR42|K4CR42_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc09g010130.2.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN= OC=Solaneae; Solanum; Lycopersicon.
Sequence
MRRQALDVFVNRIASHHELRQSDDLRIFLQADEQTMDRARFQETGIFKKKPADLIQIFKD
VQSKVSDVVLGKEKPVEESTPEYEKMKNYIFELEEHLAEAQKHAYRLVKRHRELGESLSD
FGKAVKLLGTCDDDALGKAFSELGAKSEIISIKLQKEAHHLLMNFEEPLKDYVRAVQSIK
ATIAERATAFKKQCELAETIKFKEIDLNKYKLTRSEKLAEAEREYEMLKAEGEETSRRFD
TIVRLMNEEIVRFQEQKTSDMGLAFHEFAKGQARLSNGIADAWRSLLPKLEAHSS
Download sequence
Identical sequences K4CR42
Sopim09g010130.0.1 Solyc09g010130.2.1 Solyc09g010130.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]