SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4D8J9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4D8J9
Domain Number 1 Region: 883-970
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.27e-22
Family PB1 domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K4D8J9
Sequence length 986
Comment (tr|K4D8J9|K4D8J9_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc11g045350.1.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101260397 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MERGVDFWASPKGQMEGVASFDASTRSSNVDSFNNVMEIMNLDAYAGWCTSPSAAEHMLA
SYAAFSPINHMSQSYAPFEGLSYTEQNSGAFPPMDANMVVSNHDGGEKMMFGQTDDQLHF
MVDSVDGEDGLGAKRSRRSSQPSDGADIGNSMIPRSPSQPLAERMLRALAMFKESSAAGI
LAQVWIPMKNGDQYVLSTCEQPYLLDQVLSGYREVSRKFTFDTEIKPGAIPGLPGRVFSS
RIPEWTSNVLYYKEAEYLRVQYAVNHEVRGSIALPVFEDDACETPCCAVLELVTMKEKRN
FDLEMDHVCQALQAVNLRSTAPPRLHSQNLSNNQKDALAEITDVLRAVCHAHKLPLALTW
IPCNVTEGEGDEPIRVRARGCNTSLNEKCVLCVEDTACYVSDKEMQGFVHACMEHFLEEG
EGIVGKALQSNHPFFYPDVKEYHISEYPLVHHARKFGLNAAVAIRLRSTFTGNDDYILEF
FLPTSMKGSTEQQLLLNNLSGTMQRICKSLRTVADVELVGQDTKFGLQDGSVPNLPPIAL
SRKNFQHSLDSNSNSVNEAPLGACDSKSAGTHADDSHEQTMTGSRRQIEKKRSTAEKHVS
LSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKVNRSLKKIQTVLESV
QGVEGGLKFDPASGGLVPAGSITQDFDAQRSIFFPFKDVSVKNPTSVFQDTVSVPSSSGN
DKENSMVKMEEDFFADGNQLSQSNHVNTSSFKEVTKSSIEVSGYCYESKLPLTDSGNASL
GPFLSKGGCRRWGLNNDTLDNVDCQFTSQCSYSMAVGSDVDSKMKEDNEMDGDGGVIEHN
QASSSAMTDSSNGSESMINGSSSSTHSRGAEKHSKIEVNCGDNGSTITVKATYKEDTIRF
KFDLSAGCFQLYEDIAKRFKLHTETFQLKYLDEEEEWVMLVNDADLHECLEILDFSGGRT
VKFLVRDTPCALGSSGSSNCFLASGS
Download sequence
Identical sequences K4D8J9
Solyc11g045350.1.1 XP_004250776.1.44838 XP_010313114.1.44838 Solyc11g045350.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]