SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4DAA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4DAA6
Domain Number 1 Region: 110-216
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.62e-29
Family B3 DNA binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  K4DAA6
Domain Number - Region: 590-662
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0173
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K4DAA6
Sequence length 699
Comment (tr|K4DAA6|K4DAA6_SOLLC) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=100529137 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MKEVLEKCVDSQLWHACAGGMVQIPPVNSKVYYFPQGHAEHTLMNVDFSALPRSPALILC
RVAAVKFLADPETDEVYAKIRVVPVGNKGNDFDDDDDILGSNESGTAEKPNSFAKTLTQS
DANNGGGFSVPRYCAETIFPRLDYTADPPVQTVTAKDVHGESWKFRHIYRGTPRRHLLTT
GWSSFVNQKKLVAGDSIVFLRAENGELCVGIRRAKRGGIGGPEAPSGWNSGAGNYGGFSA
FLREEMSKNGNLTSPTRSLRGKGRVRPESVVEAAYLASSGQPFEVVYYPRANTPEFCVRA
SSVNAAMRIQWCSGMRFKMAFETEDSSRISWFMGTISSIQLADPIRWPNSPWRLLQVAWD
EPDLLQNVKHVSPWLVELVSNMPVIHLSPFSPPRKKLRLPPDFSLDSQFQLPSFSGNPLR
SSSPFCCLSDNITAGIQGARHAQFGVPLLDLHLSNKLPSGLLPPSFQRVAANSQLPNVIN
KCQNDRNDNISCLLTMGTSSKTLDKNDSVNTPRFLLFGQPILTEQQISNGCSVSAPQVVQ
TGKDLGRIQPINEKHPSEQKGSIQDNLSSATFFWNRGYHAAELGVLNTGHCKVFLESEDV
GRTLDLSVMGSYEELYKRLANMFGLERPDMLTRVLYHDATGAVKHTGDEPFSDFVKSAKR
LTILMNSSSNIKRKWLTGLATAERGLDSSNQAGPLSIFA
Download sequence
Identical sequences K4DAA6
Solyc11g069500.1.1 Solyc11g069500.1.1 NP_001234796.2.44838 XP_010313187.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]