SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4DBR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4DBR7
Domain Number 1 Region: 128-224
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.29e-18
Family B3 DNA binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K4DBR7
Sequence length 235
Comment (tr|K4DBR7|K4DBR7_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc12g007300.1.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101254974 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MVKLEKEDIEAALLLSWLKYVPVFPKKEEKSKRKHRRFIKNETPEIQIPKRVKNSPSASG
FEVYGAGNPKRVRLSSNSNGGQAASSSRNSNPVPKRGRVSPSNLPGSLPKFPPIENLTTL
IGQCSNPFVKQLTNSDVNGHQGRFLLSNEYVRNQLLPLLNEKSEDLTTGISVKTFDPMGK
YCNMKFKTWGNHKTYLLLGSWKQFVQEHGLKVSDCVTGWMFRHNRTGELCFALTW
Download sequence
Identical sequences K4DBR7
Solyc12g007300.1.1 Solyc12g007300.1.1 Sopim12g007300.0.1 XP_004251622.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]