SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4DDW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4DDW3
Domain Number 1 Region: 54-171
Classification Level Classification E-value
Superfamily CBS-domain pair 3.79e-26
Family CBS-domain pair 0.00086
Further Details:      
 
Domain Number 2 Region: 232-346
Classification Level Classification E-value
Superfamily CBS-domain pair 8.29e-22
Family CBS-domain pair 0.0014
Further Details:      
 
Domain Number 3 Region: 402-493
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.65e-17
Family PB1 domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K4DDW3
Sequence length 543
Comment (tr|K4DDW3|K4DDW3_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc12g032950.1.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101247795 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MSSQVPPAPRRNSLVQKRNISTLKKSVNQSDTNPPTSQSQSKPSSPPHSSVAGERTVKKL
RLSKALTIPEGTTVSEACRRMAARRIDAVLLTDANALLSGIVTDKDIATRVIAEELRPEQ
TIISKVMTRNPIFVAADSSAIEALQKMVQGKFRHLPVVENGEVIALLDITKCLFDAISRM
EKAAEQGSAIAAAVEGVERQWGNNFSAPSAFIETLRELIFKPSLSAIVSENTKVAIVCPS
DPVYVAAKKMRELRVNSALITVGNKIQGILTSKDILMRVVAQNLSPELTLVEKVMTSNPE
CATLETTILEALHIMHDGKFLHLPIIDRDGCVVACIDVLQITHAAISMVENSSGAVNEMA
NTMMQKFWDSALNLEPPDDYDSLSEMSMSQLMMSEGAEAGKSGYPLLGLGNTFAFKFVDL
KGRVNRFNFGSESLLELVTAVVQRLGAVDEQNRPQLLYEDDEGDKVLLTTDSDLVGAISH
ARSLGLKVLRLHLDYSDVKAVQGLSSPSVENDGWGSVRMGIFAGAVVLTSVGVLAYLKRT
NTW
Download sequence
Identical sequences K4DDW3
Sopim12g032950.0.1 XP_004252207.1.44838 Solyc12g032950.1.1 Solyc12g032950.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]