SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4DFS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4DFS6
Domain Number 1 Region: 119-229
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000392
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K4DFS6
Sequence length 235
Comment (tr|K4DFS6|K4DFS6_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc12g055950.1.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101247595 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MGDGPRGIEVFEDHFQASTSGEDPMHSPDLSKYIGSNDSLRSISRSWTRRKLKGAASILN
MFSLNKLPWMSGTDGQEKVVLTAAEVESLRSELGALEEREAHCKAQLEHIDEVVRAARLS
GYLDMRMRWATLPGEPLPVDDTDVDDWLPRFFVLQGSCIFWYSSCTDLSPQDSTLLSDVV
EVGTLPCLIRDNEDKRYCFYISTRYGLKYECSSISKIKVDSWLEALQSDCKLRSD
Download sequence
Identical sequences K4DFS6
Solyc12g055950.1.1 XP_004252611.1.44838 Solyc12g055950.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]