SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4IDJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4IDJ3
Domain Number 1 Region: 48-193
Classification Level Classification E-value
Superfamily Virus ectodomain 5.5e-36
Family Virus ectodomain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K4IDJ3
Sequence length 268
Comment (tr|K4IDJ3|K4IDJ3_9MONO) Fusion glycoprotein F0 {ECO:0000256|SAAS:SAAS00628579} OX=12814 OS=Respiratory syncytial virus. GN=F OC=Mononegavirales; Pneumoviridae; Pneumovirus; unclassified Pneumovirus.
Sequence
SRGYFSALRTGWYTSVITIELSNIKETKCNGTDTKVKLIKQELDKYKNAVTELQLLMQNT
PAANNRARREAPQYMNYTINTTKNLNVSISKKRKRRFLGFLLGVGSAIASGIAVSKVLHL
EGEVNKIKNALLSTNKAVVSLSNGVSVLTSKVLDLKNYINNQLLPIVNQQSCRISNIETV
IEFQQKNSRLLEITREFSVNAGVTTPLSTYMLTNSELLSLINDMPITNDQKKLMSSNVQI
VRQQSYSIMSIIKEEVLAYVVQLPIYGV
Download sequence
Identical sequences K4I028 K4I032 K4I043 K4I0T1 K4I0T6 K4I0U2 K4I0U7 K4I0V8 K4I2A9 K4I2B7 K4I2C4 K4I2C9 K4I4M6 K4I4N1 K4I4N5 K4I4P0 K4I4P3 K4IDI0 K4IDI9 K4IDJ3 K4IDK8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]