SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4LH16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4LH16
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 4.84e-45
Family N-utilization substance G protein NusG, N-terminal domain 0.0000288
Further Details:      
 
Domain Number 2 Region: 118-174
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 4.73e-18
Family N-utilization substance G protein NusG, C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K4LH16
Sequence length 175
Comment (tr|K4LH16|K4LH16_9FIRM) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome; Reference proteome OX=1131462 OS=Dehalobacter sp. CF. GN=DCF50_p1911 OC=Dehalobacter.
Sequence
MTKNWYVIHTYSGYENKVKTNLEKRVESMNMEDKIFRVLVPMEDEIEIKNGKKKISKRKV
FPGYVLVEMDMTDDSWYVVRNTPGVTGFVGSGSKPIPLLDQEVAVILRQMGLEKIRTKID
VVVGQSVRVISGPFKDFIGVVKEVLEEKQKVRVSVSMFGRETPVELEFGQVEKLD
Download sequence
Identical sequences K4LH16 T0JJN8
WP_015043955.1.6016 WP_015043955.1.71633 WP_015043955.1.88763 gi|410658540|ref|YP_006910911.1| gi|410661527|ref|YP_006913898.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]