SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K6ZA12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K6ZA12
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-18
Family HkH motif-containing C2H2 finger 0.044
Further Details:      
 
Domain Number 2 Region: 54-78
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000366
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K6ZA12
Sequence length 170
Comment (tr|K6ZA12|K6ZA12_PANTR) Zinc finger, matrin-type 5 {ECO:0000313|EMBL:JAA01356.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=ZMAT5 OC=Catarrhini; Hominidae; Pan.
Sequence
MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKF
LLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPKGHLEDWLEKRAKR
LSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG
Download sequence
Identical sequences K6ZA12
ENSPTRP00000024512 9598.ENSPTRP00000024512 ENSPTRP00000024512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]