SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K6ZNN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K6ZNN6
Domain Number 1 Region: 138-470
Classification Level Classification E-value
Superfamily L domain-like 3.49e-65
Family Internalin LRR domain 0.015
Further Details:      
 
Domain Number 2 Region: 32-195
Classification Level Classification E-value
Superfamily L domain-like 3.49e-31
Family Ngr ectodomain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K6ZNN6
Sequence length 587
Comment (tr|K6ZNN6|K6ZNN6_PANTR) Leucine rich repeat containing 15 {ECO:0000313|EMBL:JAA06556.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0023542 OC=Catarrhini; Hominidae; Pan.
Sequence
MPLDKAMPLKHYLLLLVGCQAWGAGLAYHGCPSECTCSRASQVECTGARIVAVPTPLPWN
AMSLQILNTHITELNESPFLNISALIALRIEKNELSRIMPGAFRNLGSLRYLSLSNNKLQ
VLPIGLFQGLDSLESLLLSSNQLVQIQPAHFSQCSNLKELQLHGNHLEYIPDGAFDHLVG
LTKLNLGKNSLTHISPRVFQHLGNLQVLRLYENRLTDIPMGTFDGLVNLQELALQQNQIG
LLSPGLFHNNHNLQRLYLSNNHISQLPPSIFMQLPQLNRLTLFGNSLKELSPGIFGPMPN
LRELWLYDNHISSLPDNVFSNLRQLQVLILSRNQISFISPGAFNGLTELRELSLHTNALQ
DLDGNVFRMLANLQNISLQNNRLRQLPGNIFANVNGLMAIQLQNNQLENLPLGIFDHLGK
LCELRLYDNPWRCDSDILPLRNWLLLNQPRLGTDTVPVCFSPANVRGQSLIIINVNIAVP
SVHVPEVPSYPETPWYPDTPSYSDTTSVSSTTELTSPVEDYTDLTTIQVTDDRSVWGMTQ
AQSGLAIAAIVIGIVALACSLAACIGCCCCKKRSQAVLMQMKAPNEC
Download sequence
Identical sequences K6ZNN6
ENSPTRP00000027103 ENSPTRP00000027103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]