SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K6ZQL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K6ZQL2
Domain Number 1 Region: 517-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000237
Family Laminin-type module 0.00019
Further Details:      
 
Domain Number 2 Region: 462-519
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.00095
Further Details:      
 
Domain Number 3 Region: 28-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000113
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 4 Region: 84-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 5 Region: 142-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  K6ZQL2
Domain Number - Region: 379-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000781
Family EGF-type module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K6ZQL2
Sequence length 1193
Comment (tr|K6ZQL2|K6ZQL2_PANTR) Laminin, gamma 2 {ECO:0000313|EMBL:JAA07276.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=LAMC2 OC=Catarrhini; Hominidae; Pan.
Sequence
MPALWLGCCLCFSLLLPAARATSRREVCDCNGKSRQCIFDRELHRQTGNGFRCLNCNDNT
DGIHCEKCKNGFYRHRERDRCLPCNCNSKGSLSARCDNSGQCSCKPGVTGARCDRCLPGF
HMLTDAGCTQDQRLPDSKCDCDPAGIAGPCDAGRCVCKPAVTGERCDRCRSGYYNLDGGN
PEGCTQCFCYGHSASCRSSAEYSVHKITSTFHQDVDGWKAVQRNGSPAKLQWSQRHQDVF
SSAQRLDPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRHPSAHDVILEGAGLRITAPL
MPLGKTLPCGLTKTYTFRLNEHPSSNWSPQLSYFEYRRLLRNLTALRIRATYGEYSTGYI
DNVTLISARPVSGAPAPWVEQCICPVGYKGQFCQDCASGYKRDSARLGPFGTCIPCNCQG
GGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVV
CNNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDQLTGRCLK
CIHNTAGIYCDQCKAGYFGDPLAPNPADKCRACNCNPMGSEPVGCRSDGTCVCKPGFGGP
NCEHGEFSCPACYNQVKIQMDQFMQQLQRMEALISKAQGGDGVVPDTELEGRMQQAEQAL
QDILRDAQISEGASRSLGLQLAKVRSQENSYRSRLDDLKMTVERVRALGSQYQNRVRDTH
RLITQMQLSLAESEASLGNTNIPASDHYVGPNGFKSLAQEATRLAESHVESASNMEQLTR
ETEDYSKQALSLVRKALHEGVGSGSGSPDGAVVQGLVEKLEKTKSLAQQLTREATQAEIE
ADRSYQHSLRLLDSVSRLQGVNDQSFQVEEAKRIKQKADSLSSLVTRHMDEFKRTQKNLG
NWKEEAQQLLQNGKSGREKSDQLLSRANLAKSRAQEALSMGNATFYEVESILKNLREFDL
QVDNRKAEAEEAMKRLSYISQKVSDAGDKTQQAERALGSAAADAQRAKNGAGEALEISSE
IEQEIGSLNLEANVTADGALAMEKGLASLKSEMREVEGELERKELEFDTNMDAVQMVITE
AQKVDTRAKNAEVTIQDTLNTLDGLLHLMDQPVSVDEEGLILLEQKLSRAKTQINSQLRP
MMSELEERARRQRGHLHLLETSIDGILADVKNLENIRDNLPPGCYNTQALEQQ
Download sequence
Identical sequences K6ZQL2
ENSPTRP00000002941 9598.ENSPTRP00000002941 ENSPTRP00000002941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]