SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7B4S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7B4S4
Domain Number 1 Region: 230-413
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-69
Family SPRY domain 0.00000227
Further Details:      
 
Domain Number 2 Region: 38-146
Classification Level Classification E-value
Superfamily Immunoglobulin 8.56e-17
Family V set domains (antibody variable domain-like) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7B4S4
Sequence length 475
Comment (tr|K7B4S4|K7B4S4_PANTR) Erythroblast membrane-associated protein (Scianna blood group) {ECO:0000313|EMBL:JAA01622.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0025524 OC=Catarrhini; Hominidae; Pan.
Sequence
MEMASSAGSWLSGCLIPLVFLRLSVHVSGRAGDAGKFHVALLGGTAELLCPLSLWPGTVP
KEVRWLRSPFPQRSQAVHVFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLED
QGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQR
RAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAV
TLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVVSILGSEYFTTGCHYWEVYVG
DKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGI
FLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEE
SIVPKPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF
Download sequence
Identical sequences K7B4S4
ENSPTRP00000001073 9598.ENSPTRP00000001073 ENSPTRP00000001073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]