SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7BZX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7BZX2
Domain Number 1 Region: 157-353
Classification Level Classification E-value
Superfamily RNI-like 4.71e-37
Family Cyclin A/CDK2-associated p19, Skp2 0.00000000592
Further Details:      
 
Domain Number 2 Region: 89-143
Classification Level Classification E-value
Superfamily F-box domain 2.75e-16
Family F-box domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7BZX2
Sequence length 410
Comment (tr|K7BZX2|K7BZX2_PANTR) SKP2 isoform 2 {ECO:0000313|EMBL:PNI25645.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0044881 OC=Catarrhini; Hominidae; Pan.
Sequence
MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLG
HPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSP
FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC
SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS
DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLLVTRAG
VRIRLDSDIGCPQTYRTSKLKSSHKLFCQHVRVICIFVCDFYFYRLVLKQ
Download sequence
Identical sequences K7BZX2
ENSP00000274254 ENSP00000274254 gi|14249170|ref|NP_116026.1| NP_116026.1.87134 NP_116026.1.92137 XP_016808911.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]