SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7CKN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7CKN4
Domain Number 1 Region: 53-149,183-431
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-54
Family Myotubularin-like phosphatases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7CKN4
Sequence length 650
Comment (tr|K7CKN4|K7CKN4_PANTR) Myotubularin related protein 14 {ECO:0000313|EMBL:JAA26894.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=MTMR14 OC=Catarrhini; Hominidae; Pan.
Sequence
MAGARAAAAAASAGSSASSGNQPPQEPGLGELLEEFSRTQYRAKDGSGTGGSKVERIEKR
CLELFGRDYCFSVIPNTNGDICGHYPRHIVFLEYESSEKEKDTFESTVQVSKLQDLIHRS
KMARCRGRFVCPVILFKGKHICRSATLAGWGELYGRSGYNYFFSGGADDAWADVEDVTEE
DCALRSGDTHLFDKVRGYDIKLLRYLSVKYICDLMVENKKVKFGMNVTSSEKVDKAQRYA
DFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAPLSIPDFLTHSLNIDWSQYQC
WDLVQQTQNYLKLLLSLVNSDDDSGLLVHCISGWDRTPLFISLLRLSLWADGLIHTSLKP
TEILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFSALKTQRRKSLPARD
GGFTLEDICMLRRKDRGSTTSLGSDFSLVMESSPGATGSFTYEAVELVPAGAPTQAAWRK
SHSSSPQSVLWNRPQPSEDRLPSHQGLAEARSSSSSSSNHSDNFFRMGSSPLEVPKPRSV
DHPLPGSSLSTDYGSWQMVTGCGSIQERAVLHTDSSLPFSFPDELPNSCLLAALSDRETR
LQEVRSAFLAAYSSTVGLRAVAPSPSGAIGGLLEQFARGVGLRGISSNAL
Download sequence
Identical sequences G3QLV6 K7CKN4
ENSGGOP00000003475 XP_004033594.1.27298 ENSGGOP00000003475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]