SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7CR72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7CR72
Domain Number 1 Region: 388-612
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.8e-35
Family Calponin-homology domain, CH-domain 0.00039
Further Details:      
 
Domain Number 2 Region: 85-242,380-462
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.74e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.061
Further Details:      
 
Domain Number 3 Region: 723-754
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000523
Family LIM domain 0.00055
Further Details:      
 
Domain Number 4 Region: 689-722
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000132
Family LIM domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7CR72
Sequence length 1067
Comment (tr|K7CR72|K7CR72_PANTR) Microtubule associated monooxygenase, calponin and LIM domain containing 1 {ECO:0000313|EMBL:JAA26760.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0000554 OC=Catarrhini; Hominidae; Pan.
Sequence
MASPTSTNPAHAHFESFLQAQLCQDVLSSFQELCGALGLEPGGGLPQYHKIKDQLNYWSA
KSLWTKLDKRAGQPVYQQGRACTSTKCLVVGAGPCGLRVAVELALLGARVVLVEKRTKFS
RHNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLLLLKVALLLGVEIHWGVT
FTGLQPPPRKGSGWHAQLQPNPPAQLANYEFDVLISAAGGKFVPEGFKVREMRGKLAIGI
TANFVNGRTVEETQVPEISGVARIYNQSFFQSLLKATGIDLENIVYYKDDTHYFVMTAKK
QCLLRLGVLRQDWPDTDRLLGSANVVPEALQRFARAAADFATHGKLGKLEFAQDAHGQPD
VSAFDFTSMMRAESSARVQEKHGARLLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMV
KRWAEGAESLEVLAERESLYQLLSQTSPENMHRNVAQYGLDPATRYPNLNLRAVTPNQVR
DLYDVLAKEPVQRNNDKTDTGMPATGSAGTQEELLRWCQEQTAGYPGVHVSDLSSSWADG
LALCALVHRLQPGLLEPSELQGLGALEATAWALKVAENELGITPVVSAQAVVAGSDPLGL
IAYLSHFHSAFKSTAHSPGPVSQASPGTSSAVLFLSKLQRTLQRSRAKENAEDAGGKKLR
LEMEAETPSTEVPPDPEPGVPLTPPSQHQEAGAGDLCALCGEHLYVLERLCVNGHFFHRS
CFRCHTCEATLWPGGYEQHPGDGHFYCLQHLPQPDHKEEGSDRGPESPELPTPSENSMPP
GLSTPTASQEGASPVPDPSQPTRRQIRLSSPERQRLSSLNLTPDPEMEPPPKPPRSCSAL
ARHALESSFVGWGLPVQSPQALVAMEKEEKESPFSSEEEEEDVPLDSDVEQALQTFAKTS
ATMNNYPTWRRTLLRRAKEEEMKRFCKAQTIQRRLNEIEAALRELEAEGVKLELALRRQS
SSPEQQKKLWVGQLLQLVDKKNSLVAEEAELMITVQELNLEEKQWQLDQELRGYMNREET
LKTAADRQAEDQVLRKLVDLVNQRDALIRFQEERRLSELALGTGAQG
Download sequence
Identical sequences K7CR72
ENSPTRP00000031574 XP_001153612.1.37143 ENSPTRP00000031574 9598.ENSPTRP00000031574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]