SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7DHN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7DHN2
Domain Number 1 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 568-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 400-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 9-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.37e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 232-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000127
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 8 Region: 530-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000744
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 613-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000207
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 10 Region: 447-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000102
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 11 Region: 102-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000212
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 12 Region: 179-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000236
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7DHN2
Sequence length 659
Comment (tr|K7DHN2|K7DHN2_PANTR) Zinc finger protein 304 {ECO:0000313|EMBL:JAA41059.1, ECO:0000313|Ensembl:ENSPTRP00000075433} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0046323 OC=Catarrhini; Hominidae; Pan.
Sequence
MAAAVLMDRVQSCVTFEDVFVYFSREEWELLEEAQRFLYRDVMLENFALVATLGFWCEAE
HEAPSEQSVSVEGVSQVRTAESGLFQKAHPCEMCDPLLKDILHLAEHQGSHLTQKLCTRG
LCRRRFSFSANFYQHQKQHSGENCFRGDDGGASFVKSCTVHMLGRSFTCREEGMHLPDSS
GLFQHQTTYNRVSPCRRTECMESFPHSSSLRQHQGDYDGQMLFSCGDEGKAFLDTFTLLD
SQMTHAEVTPFRCLPCGNVFKEKSALINHRKIHSGEISHVCKECGKAFIHLHHLKMHQKF
HTGKRHYTCSECGKAFSRKDTLVQHQRVHTGERSYDCSECGKAYSRSSHLVQHQRIHTGE
RPYKCNECGKAFSRKDTLVQHQRFHTGERPYECSECGKFFSQSSHLIEHWRIHTGARPYE
CIECGKFFSHNSSLIKHRRVHTGARSYVCSKCGKAFGCKDTLVQHQIIHTGARPYECSEC
GKAFSRKDTLVQHQKIHTGERPYECGECGKFFSHSSNLIVHQRIHTGAKPYECNECGKCF
SHNSSLILHQRVHTGARPYVCSECGKAYISSSHLVQHKKVHTGARPYECSECGKFFSRNS
GLILHQRVHTGEKPYVCSECGKAYSRSSHLVRHQKAHTGERAHECNSFGDPLAASLKLV
Download sequence
Identical sequences K7DHN2
XP_016792440.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]