SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7DZ37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7DZ37
Domain Number 1 Region: 278-437
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.09e-40
Family Retroviral integrase, catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 18-160
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.71e-27
Family Ribonuclease H 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7DZ37
Sequence length 472
Comment (tr|K7DZ37|K7DZ37_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000038788} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MAEKPRDNLLDTPLDNADLILFTDGSSFMRDGIRYTGAAVVSEFATEWSASLPSNISAQG
AELIALKHACIIAKDKKATIYMDSRYAFGICHSVGMLWLQRGFLTSAGKSIANAEIINEV
LSALKLPKALAVVHCSAHTGGSDPVSRGNDRADAAAKLAAIEGPGLILTLTTTDNLNLSL
SYNEKEVEKWKQKFKAKQINGVWVSSEGKPLLPRSFYNQICQSIHNNGHFGTQGIVDSVK
RVWIAPGITTIASKVCSSCSTCQAYNQHAFRGKAFGGRPLAYTPFEHLQIDFITMPKAGQ
YKFCLVIVDQLTRWPEAFPTARATAAFVAKVLLKEIIPRFGLPARIDSDRGSHFTDSVLN
QIYSCLGITPKFHVPYHPQSSGQVERMNKELKTMIGKLCTETHLKWPEILPLALFYLRSR
PRGDLHISPFEMLFGHPPIQAKPFSPAYTSLLGGDTTIASYIQELQQQLREL
Download sequence
Identical sequences K7DZ37
ENSMODP00000038788 ENSMODP00000038788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]