SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7E0W2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K7E0W2
Domain Number - Region: 55-114
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0254
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7E0W2
Sequence length 346
Comment (tr|K7E0W2|K7E0W2_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000039413} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MGNDQRANGRTKEEGTSRNKNGNPVNWIQALGSYKMQFNTQLREAEDNWEKNFKSKISHL
ETENSFLKAKINQIENESKEMIDEAKKTKPEAKEMRDEVKRMKDDLQRKSEQKEKDDQKA
RDEIQSLRTRIQQLALSDLTRQQGTRTQNQKNEKIEENMKHPIHKTENLENYSRRVNLRI
ISLPEDHDKRKSLDVILQDYISLKTIEQEGKVEIERIHRSPPLLNPQLTTPRNIIAKFKN
YQTKEKILQAAKKKSFRHQRTTVRITQDLAASTLKDQKVWNMIFWKARELGLQPKINYPA
KLTIFLQGKVWSFNKIEEFQTFVKKRPDLNRVFDAQAQNSRESSKG
Download sequence
Identical sequences K7E0W2
ENSMODP00000039413 ENSMODP00000039413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]