SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7E1J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7E1J6
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily SEA domain 1.2e-16
Family SEA domain 0.0045
Further Details:      
 
Domain Number 2 Region: 93-176
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000196
Family SEA domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7E1J6
Sequence length 185
Comment (tr|K7E1J6|K7E1J6_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000039647} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MKNRTATGVDVDCAYHEDYSIPVLDREKIYWELSEQTHGITRLGPYMIDNESLYVDGYNH
LAVAPTKMPPDPAVAPGCPLWATEPGGSQAASLSFQSFTTIPKVLYTEDMHLSGSDKFNS
TNRILQRLMKNGSESGVSDLCTHRRNPRSSDGNQEKVHWELSNKKKHITKLGLSSSLEKG
QSTQC
Download sequence
Identical sequences K7E1J6
ENSMODP00000039647 ENSMODP00000039647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]