SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7E1N4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7E1N4
Domain Number 1 Region: 886-1152
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-62
Family Protein kinases, catalytic subunit 0.000021
Further Details:      
 
Domain Number 2 Region: 584-889
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.65e-45
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 3 Region: 433-534
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000138
Family SH2 domain 0.0066
Further Details:      
 
Domain Number 4 Region: 371-438
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000369
Family Third domain of FERM 0.017
Further Details:      
 
Domain Number 5 Region: 139-267
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000209
Family Second domain of FERM 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7E1N4
Sequence length 1154
Comment (tr|K7E1N4|K7E1N4_MONDO) Tyrosine-protein kinase {ECO:0000256|PIRNR:PIRNR000636, ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=TYK2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MPLCHCAARHNDSDGDWVHPGSGLKVFLHWSNGGEQYVTYNQGTMTAEEVCIHIAKKVGI
TPLCYNLFALYDTQAQIWLPPNHLFEVTKDTNLTLQFRIRYYFRNWHGLNTQEPAVYRSM
TRNIEVSEDKIQMEQGCALLDKASFEYLFEQGKFEFVNDVASLWDLHSEAEIHHFKNESL
GMAVLHLSHLALQRGIPLEEVVRKTSFKDCIPRSFSRQIQQNNFLTKFRLRTVFQKFMRR
FHLQTVGPGHLSKQNIMFKYLATLEQLAPRFGAERFLALTLALPTEAERELCYVNSSGQT
PAGPAGSTFSLDAQVPTHEVLVMGTNGIRWRLLQEKVSELEINRPKSSFGKKSKAQKAEN
QKLSQLPTEKKDPSWTYFCDFQEITHVVVKESNVSIHRQDNKCLELTLPSPIVALSLVSL
IDGYFRLTADSSHYLCHEVAPPRLVMSIQNGIHGPLQESYVLSKLKREEVEDGLYLIRWS
SFDFHRLILTVARKDQAQGLRYKQFRIEEQGRTFQLEGWDQTFSSVRELTTALQGCTLRS
SSGSGPGSSLESFTISKCCLPRAGEISNLIITRHRPKEGPKPLNLSQLSFYQIRKDEITQ
LAHLGQGTRTNIYEGLLHVGGGMEAEDEEEENIPSEPNNNHRELRVVLKVLDPSHRDIAL
AFFETASLMSQVSHIHLAFVHGVCVRGSENIMVAEYVEHGPLDVCLRREKGHVPVAWKIT
VAQQLASALSYLEDKNLVHGNVCAKNILLARRGLGDGTQPFIKLSDPGVSVTALSREERV
ERIPWIAPECVPSGTGLSTAADKWSFGTTLLEICFDGEAPLQGRTPSEKERFYEKKHRLQ
EPSCKELATLISQCLTYEANQRPSFRTILRDLTQLQPQNLSDITTMSPEFPASDPTVFQK
RYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKSLKAGCSSQLLSSWQREIEILRTL
YHDHIVKYKGCCSDQGEKIVQLIMEYVPLGSLRDYLPKHSLGLAQILLFAQQICKGMSYL
HSQHYIHRDLAARNVLLENDNIIKIGDFGLAKAVPEGRDYYCVREDGDSPVFWYAMECLK
ESKFYYASDVWSFGVTLYELLTRCDYNQSPPLKFIEMIGVTQGQMTVLRLIDLLERGQRL
PCPKDCPSEVSSFY
Download sequence
Identical sequences K7E1N4
ENSMODP00000039685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]