SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7E1U3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7E1U3
Domain Number 1 Region: 231-344
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.18e-21
Family Retrovirus capsid protein, N-terminal core domain 0.0012
Further Details:      
 
Domain Number 2 Region: 44-112
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000288
Family Tropomyosin 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7E1U3
Sequence length 368
Comment (tr|K7E1U3|K7E1U3_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000039744} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MSTTFFDNYMAAEEVGALRNEGYLQIFILIGTVIFVLLNTIFRDEKIKNVEDKIEKNEDK
IGNIENKIEKLEDKIGNIENKIGNIEDKMGDMEDKIGKIEDKMQAQLEDLKCFLQDQWAN
THSTRNRPVSEPLNEEISFPEIEMENTFPIAQLTDCFSRAVQILSEFNPQNPSPAIPASH
VPSPTENQIPMQGRFCPPRETCPCQTDPQVQNSTRGLFPLREVPEIGRNGDVVTLRHRIP
FTPQEINEFTRNIPTYEQDPFLVTKKMGDIFFQYNPSYKDVESLLQAFLSEREKNKIIAH
VNKTRGRNAAHWPSQDPEWDYNNPEDYLQLYRCREAILTAMKECADSTDKWMELEKIKQK
ENETPSIF
Download sequence
Identical sequences K7E1U3
ENSMODP00000039744 ENSMODP00000039744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]