SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7E292 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7E292
Domain Number 1 Region: 87-215
Classification Level Classification E-value
Superfamily SEA domain 1.31e-40
Family SEA domain 0.00035
Further Details:      
 
Domain Number 2 Region: 248-318
Classification Level Classification E-value
Superfamily SEA domain 0.0000000275
Family SEA domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7E292
Sequence length 321
Comment (tr|K7E292|K7E292_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000039893} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MTSLTSGLLIRESTVYAIASEIGVGPFTHIRDHGSARDMTSVTSESTAGAMGGDAGVVPV
THAQGHEGPGSTGALMRSPLTPVSTVIPTAGSFNSKTFTINFTITNMFYKTKMGQRGSST
FRVAEFVLQHLFKVLFERSSLGSQYSGCSVTLLRSMNNGKATGVEVICSYQEFFSIPVLD
KKKIYQELSQQTNGITRLGGYILDEESLYVDGYNHLAVAPTKMPPDPAVAPGCPLWATEP
RGSQAASLSFQSFTTIPEVLYTEDMHLSGSDKFNFTKRTLQQPLKNGSASGVSCLCTHKR
NHRSSFRDQEKVYWDAKRAFH
Download sequence
Identical sequences K7E292
ENSMODP00000039893 ENSMODP00000039893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]