SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7E2G0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7E2G0
Domain Number 1 Region: 160-223
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.75e-17
Family Complement control module/SCR domain 0.00038
Further Details:      
 
Domain Number 2 Region: 98-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.24e-17
Family Complement control module/SCR domain 0.00047
Further Details:      
 
Domain Number 3 Region: 222-284
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000089
Family Complement control module/SCR domain 0.00073
Further Details:      
 
Domain Number 4 Region: 34-108
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000005
Family Complement control module/SCR domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7E2G0
Sequence length 373
Comment (tr|K7E2G0|K7E2G0_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000039961} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LOC103093588 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MSPAAQRTPLALGLFGLPSLLLLLLDLTPARGDCNAPERLHFAVLTGDSAAQQSFPEGSE
VKYTCRPGYQRNFKFPPTRTCLPDGTWSKANEFCQKKQCPNLGELTNGHIKIENDILFGS
TVSFICDEGYVLIGESQSRCEIVEGNKVGWSERLPVCEAIRCDLPPVIDNGQHTGINQDF
FTYGSVVRYRCDATYSLIGNEVIHCTTENMKDGIWSDPPPECKVVRCETPLLPNGYIQSL
RRSSYTYKETVILECNPGFNMIGKEMISCGANNTWIPDIPQCIKDVKPTTVGATTSTTTT
TSSSSSTGGSSSSTGGSSSSTGGSSSSTGGSSSSTSGSSSFANKKENQLITVFLVIPLVI
FTQTGSFSFRNWL
Download sequence
Identical sequences K7E2G0
ENSMODP00000039961 ENSMODP00000039961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]