SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7E2P2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7E2P2
Domain Number 1 Region: 346-505
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.55e-40
Family Retroviral integrase, catalytic domain 0.0015
Further Details:      
 
Domain Number 2 Region: 86-228
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.78e-27
Family Ribonuclease H 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7E2P2
Sequence length 617
Comment (tr|K7E2P2|K7E2P2_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000040043} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MCPHEIEALLVKHRTQAFSDQRITRYEITLLNSENITLKRCSTLNPATLLPDLPTSGEPL
HNCETLVSMAEKPRDNLLDTPLDNADLILFTDGSSFMRDGIRYTGAAVVSEFATEWSASL
PSNISAQGAELIALKHACIIAKDKKATIYTDSRYAFGICHSVGMLWLQRGFLTSAGKSIA
NAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGNDRADAAAKLAAIEGPGLILTLTT
TDNLNLSLSYNEKEVEKWKQKFKAKQINGVWVSSEGKPLLPRSFYHQICQSVHNNGHFGT
QGIVDSVKRVWIAPGITTIASKVCSSCPTCQVYNQHAFRGKAFGGRPLAYTPFEHLQIDF
ITMPKAGQYKFCLVIVDQLTRWPEAFPTARATAAFVAKVLLKEIIPRFGLPARIDSDRGS
HFTDSVLNQIYSCLGITPKFHVPYHPQSSGHVERMNKELKTMIGKLCTETHLKWPEILPL
ALFYLRSRPRGDLHISPFEMLFGHPPIQAKPFSPAYTSLLGGDITIASYIQELQHKLREL
HESGAAVQAGPLDFSLHDLNPGDNVYIKNFKCTGATEPSWEGPFQILLTTPTSIKVGEKD
SWIHCSHVKRASSVETD
Download sequence
Identical sequences K7E2P2
ENSMODP00000040043 ENSMODP00000040043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]