SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7E2S9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7E2S9
Domain Number 1 Region: 133-295
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000000379
Family Retroviral integrase, catalytic domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7E2S9
Sequence length 625
Comment (tr|K7E2S9|K7E2S9_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000040080} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LOC103100038 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MLREHLQLRAQRASLGANSKVSCFSPGPNLMFTRPGKKWALVVFDRKDRLKLVKQAHITS
SGVHCSLPETKKKVSFSYYWPTLVRDVTQWVKQCSCLQKSRSERSLPIQGVTKSHRGKDP
LPVLQVESVTQAFEQVGMGVVGPLVETPNGFRFILLSVDAYSRWVEASPLKEQNPVEVAG
ALIPFLLRFGRPQLLVTTLRVPFVNQVNRSLRRQLQSLGVPLGKLDIVMSAFQPKINSIL
AMTSSCIRKTLWNLLKGDLEKWDRVLDRALFTLRTAVTKNKRRSPFQILYGRKPRAAQEV
PSHFDVVAADTVTGDLEASETRDPVPKPMERPKQDSMPEPTQQSTLQPTPQSTLQLTLQP
TPQSTLQPTQQSTQQPIQQSTQQPIQQSTQQPIQQSTLQPIQQSTLQPIQQSTQQPLQQS
IQQPIPQCPQQLRPELIQQSMLESMQQPILEPGQPSGSEPMGQLLHQPLPEPLYQHIWQP
MLLGSLQQPIQQPLHPLIQQPMPLPNQQPMQLPMQLPLQQPMQQSLPQPIQQLILQPIQQ
PMQQSMQQPIQQLILQPIQQLIHQPIQQPMPQVMAEPLPPPLPRVTECHVASNWCQQTAP
ALEAPWEKWEPGGGAFWTQWRDPGN
Download sequence
Identical sequences K7E2S9
ENSMODP00000040080 ENSMODP00000040080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]