SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7E2W1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7E2W1
Domain Number 1 Region: 31-140
Classification Level Classification E-value
Superfamily Immunoglobulin 3.58e-19
Family V set domains (antibody variable domain-like) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7E2W1
Sequence length 182
Comment (tr|K7E2W1|K7E2W1_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000040112} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LOC103100637 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MEIVSSSANFLSSFLIFLLLETHTLASERFSVIGPTEPIQAWVGRKADLPCYLSPQKNAQ
AMKVIWFQSLDIVHYYEDGQDKFDNQSPKFQGRTELVKDAITRGNVTLRIWNITASDQGH
YKCHFDDGLYQEEAGIELLVSEPNPTSKYSTSRIDAGETIIFLILEIVFLLLKHLSDIIS
LH
Download sequence
Identical sequences K7E2W1
ENSMODP00000040112 ENSMODP00000040112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]