SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7E2Z1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7E2Z1
Domain Number 1 Region: 23-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000528
Family Complement control module/SCR domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7E2Z1
Sequence length 280
Comment (tr|K7E2Z1|K7E2Z1_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000040142} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MQVGLLENSSHLTCLPGHLSEAQCTNPLPPPFGSYNIVKGSGCSLGSVVDFSCQMGYQLI
GSRMMICLLGDNGTIWSHPEPHCEEVTPRSPSDGYQGAVTVPLISGAIILAISISFIRCC
LQERGLRSSSGANQAMYHQGRMANAGRRAGSAVKVQQKHVVTDGKEQRQREHLPTLLSSI
YPGALTIYDNWGFQRSQEAQPWATVQTLSCEVPVFRPTVLQQDPQSPPPTYIYLLQEPRD
LPSLLPRPHGHTRLPREPEPARPRGSNSGSMEDRAQEAQI
Download sequence
Identical sequences K7E2Z1
ENSMODP00000040142 ENSMODP00000040142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]