SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7E3R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7E3R2
Domain Number 1 Region: 102-313
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-53
Family DBL homology domain (DH-domain) 0.0000994
Further Details:      
 
Domain Number 2 Region: 330-408
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000554
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7E3R2
Sequence length 414
Comment (tr|K7E3R2|K7E3R2_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000040414} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MVAHDEIGSFLPIKRTIRVLDVNNQSFREQEEPSNKRVRSLARVSSLANLISPVRNGAVK
RFGQTIQSFTLRGDNRSPACAQKSFNRATVPTPSKRRNSVRWSEMLDINMKESLTTKEIK
RQEAIYEMLRGEQDLIEDLKPARKAYHDPMLKLSIMSEEELTHIFGDLDAYIPLHEDLLA
RLGEATKPDGTVEQIGHILVNWLPGLNAYRGYCSNQLAANALLDQKKQDARVQDFLQRCL
ESPFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPKDHTDIKPLEEALLVIQGVLSDIN
LKKGESECQYYIDKLEYLDDKQKDPRIEASKVLLCHGELKNKNGHKLYIFLFQDILVLTR
PVIRNERHSYQVYRQPIPVKELVLEDLQDGDVRMGGSFRGAFSNSDKGKEKSFR
Download sequence
Identical sequences K7E3R2
ENSMODP00000040414 ENSMODP00000040414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]