SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7E4B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7E4B3
Domain Number 1 Region: 118-328
Classification Level Classification E-value
Superfamily DNase I-like 7.07e-35
Family DNase I-like 0.071
Further Details:      
 
Domain Number 2 Region: 20-60
Classification Level Classification E-value
Superfamily UBA-like 0.0000000485
Family TAP-C domain-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7E4B3
Sequence length 329
Comment (tr|K7E4B3|K7E4B3_MONDO) Tyrosyl-DNA phosphodiesterase 2 {ECO:0000313|Ensembl:ENSMODP00000040615} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=TDP2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
AFGAMEVDGTVAAPEERVVEERQRLCAEFAAITGRGCDVAQCYLAENDWQMERALNSYFE
AAVDLGALDSRTPTPPTPPLAPTPAEAVCVDLTNEPTIDITNTDVNIENCVQKEDDSTFS
LITWNIDGLDINNLQARARSVCEYLALYTPDVVFLQEVIPPYYDYLKKRATSYRIISGNE
DGYFTVVMLKKSRVKLMSHEITPFPATQMMRNLLCVHVSVCGNELCLMSSHLESTRNHSR
ERMNQLKIVLKKMQEIPESVTVIFGGDTNLRDHEVSKVGGLPDKILDVWEFLGKPEHCRY
TWDTQANTNLAIEASCKLRFDRIFFRPAA
Download sequence
Identical sequences K7E4B3
ENSMODP00000040615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]