SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7E592 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7E592
Domain Number 1 Region: 169-311
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.13e-25
Family Ribonuclease H 0.0037
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.78e-18
Family Reverse transcriptase 0.0000503
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7E592
Sequence length 349
Comment (tr|K7E592|K7E592_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000040944} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MSTPALGIPDYNKPFTLYVHERRGVASGVLTQTLGPSQRPIAYYSAQLDPVAAGAPPCLR
GVAATALLVTKTVDLVLGCPLTIMCPHEIEALLVKHRTQAFSDQRITRYEITLLNSENIS
LKRCSTLNPATLLPDLPTSGEPLHNCETLVSMAEKPRDNLLDTPLDNADLILFTDGSSFM
RDGISYTGAAVVSEFATEWSASLPSNISAQGAQLIALKHACIIAKDKKATIYTDSRYPFG
ICHSVGMLWLQRGFLTSAGKSIANAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGN
DRADAAAKLAAIEGPGLILTLTTTDNLNLSLSYNEKEVEKWKQKFKAKQ
Download sequence
Identical sequences K7E592
ENSMODP00000040944 ENSMODP00000040944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]