SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7E9Q2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7E9Q2
Domain Number 1 Region: 63-164
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-24
Family Spectrin repeat 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7E9Q2
Sequence length 180
Comment (tr|K7E9Q2|K7E9Q2_ORNAN) Uncharacterized protein {ECO:0000313|Ensembl:ENSOANP00000030259} KW=Complete proteome; Reference proteome OX=9258 OS=Ornithorhynchus anatinus (Duckbill platypus). GN= OC=Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Sequence
MNVTTSREKLLRVSSQDYGRSLPAVQNLQKKHKRLEGELLAHETAIQGVLDTASQLVDND
AVGRDQIQQRLAQLEQHWKELNASAKIRGLRLDESLQYLQFMEEAEEEEAWINEKTALIS
GGDFGDSLIATQGLLKKHEAFETDFATHEVRVRDVCTQGNEILSKVRTKELPPSFLLPGR
Download sequence
Identical sequences K7E9Q2
ENSOANP00000030259 ENSOANP00000030259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]