SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7EBV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7EBV2
Domain Number 1 Region: 1-56
Classification Level Classification E-value
Superfamily GAS2 domain-like 4.18e-22
Family GAS2 domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7EBV2
Sequence length 68
Comment (tr|K7EBV2|K7EBV2_ORNAN) Uncharacterized protein {ECO:0000313|Ensembl:ENSOANP00000031009} KW=Complete proteome; Reference proteome OX=9258 OS=Ornithorhynchus anatinus (Duckbill platypus). GN= OC=Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Sequence
MIKVSEGKYKVGDSSALIFVRVLRRHVMVRVGGGWDTLEHYLDNHDPCRCTSLCEYLGQL
RWSWGSWG
Download sequence
Identical sequences K7EBV2
ENSOANP00000031009 ENSOANP00000031009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]