SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7ECL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7ECL1
Domain Number 1 Region: 67-183
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-29
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 7-57
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000000994
Family Calponin-homology domain, CH-domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7ECL1
Sequence length 187
Comment (tr|K7ECL1|K7ECL1_ORNAN) Uncharacterized protein {ECO:0000313|Ensembl:ENSOANP00000031268} KW=Complete proteome; Reference proteome OX=9258 OS=Ornithorhynchus anatinus (Duckbill platypus). GN=LOC100092630 OC=Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Sequence
MNTVAVQSNLANLEHAFYVAEKIGVTRLLDPEDVDVSSPDEKSVITYVSSLYDAFPKVPE
GGEGINANDVEVKWVEYQNMVNYLIQWIRHHVTIISDRTFPNNPIELKALYNQYLQFKET
EIPPKEIEKSKIKRLYKLLEVWIEFGRIKLLQGYHPNDIEKEWGKLIIAMLEREKLLRPE
VERYVCM
Download sequence
Identical sequences K7ECL1
ENSOANP00000031268 ENSOANP00000031268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]