SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7EEU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7EEU8
Domain Number 1 Region: 40-115
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.7e-23
Family GAS2 domain 0.00048
Further Details:      
 
Domain Number 2 Region: 5-26
Classification Level Classification E-value
Superfamily EF-hand 0.0000406
Family Polcalcin 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7EEU8
Sequence length 140
Comment (tr|K7EEU8|K7EEU8_ORNAN) Uncharacterized protein {ECO:0000313|Ensembl:ENSOANP00000032055} KW=Complete proteome; Reference proteome OX=9258 OS=Ornithorhynchus anatinus (Duckbill platypus). GN= OC=Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Sequence
MSAVASIFDTNGDGFIDYCEFVSALHPSRDPRGRGPDADRIQDEVTRQVSQCNCARRFLV
EQISANRYRFGESQQLRMVRILRSSLMVRVGGGWIALDEFLVKNDPCRGEGRSNDQPVDD
IDREQGAVLSGWERTVQQSW
Download sequence
Identical sequences K7EEU8
ENSOANP00000032055 ENSOANP00000032055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]